20% OFF shipping at mein-werk.net on orders over $79 + up to 10% OFF products
mein-werk.net
home > Recombinant Human G-CSF protein(N-His)(active) - PKSH034164 > Recombinant Human G-CSF protein(N-His)(active) - PKSH034164
download picture
Recombinant Human G-CSF protein(N-His)(active) - PKSH034164Recombinant Human G CSF protein(N His)(active) Sizes: 20g, 100g Catalogue Numbers: PKSH034164 20, PKSH034164 100 Citations, Manuals and MSDS Available upon request. Abbreviation: G CSF Target Symptom: CSF 3; MGI 1G; GM CSF beta; pluripoietin Target Species: Human Expression Host: E. coli Application: Cell culture Fusion Tag: N His UNIProt ID: Q8N4W3 Accession: Q8N4W3 Background: Granulocyte macrophage colony stimulating factors are cytokines that act
Shopping security

Shopping security

Each payment you make on thelockerguy is secured with strict SSL encryption and PCI DSS data protection protocols
Recombinant Human G-CSF protein(N-His)(active) Sizes: 20μg, 100μg Catalogue Numbers: PKSH034164-20, PKSH034164-100 Citations, Manuals and MSDS Available upon request. Abbreviation: G-CSF Target Symptom: CSF-3; MGI-1G; GM-CSF beta; pluripoietin Target Species: Human Expression Host: E.coli Application: Cell culture Fusion Tag: N-His UNIProt ID: Q8N4W3 Accession: Q8N4W3 Background: Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes. Activity: Measure by its ability to induce proliferation in NFS-60 cells. The ED50 for this effect is < 50 pg/mL. The specific activity of recombinant human G-CSF is > 2 x 107IU/mg. Sequence: MSPEPALSPALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP Purity: > 98 % as determined by reducing SDS-PAGE. Formulation: Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. Reconstitution: Please refer to the printed manual for detailed information. Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method. Calculated MW: 22.37 kDa Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months. Shipping: This product is provided as lyophilized powder which is shipped with ice packs. Research Use Only

Recombinant Human G-CSF protein(N-His)(active) - PKSH034164

Item no : 1581191797
sold recently : Login >>
US$ 174.30
Pay in 4 interest-free payments of $43.58 Learn more
Min. order: 1piece

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 15 - Jul 20

Enjoy 20% off shipping

US$ 174.30

1-11

US$ 156.87

12-35

US$ 122.01

36-59

US$ 104.58

60+

US$40

Get now

Sign up to your membership to get coupons up to

15%

Get now

Opportunity to enjoy order discount up to 15% off

Please add the products
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

recommand products

Related Searches